PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G283000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 362aa    MW: 38409.1 Da    PI: 9.1231
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G283000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.9e-32179232255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Seita.1G283000.1.p 179 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 232
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15177233IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28177232IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23179233IPR006447Myb domain, plants
PfamPF002491.9E-7180231IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPPAT KPMELGFWKR ALDTTSPATT TAAAAAVAAT TAPSLSFASS  60
APTTAVGFHA AAGGHHHHQA PGSHFGLPFL HHTQPILPEG GGGGGLRDLA SMRPIRGIPV  120
YNISQPLPFL QSHPHHHHHH QHCYDAIAGM GHSGGGPRSP KAAALRLAGA PAKRGARAPR  180
MRWTTSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTIKTTDHKP  240
ASASSYGQAG AKTIIDIPDD NLFDVTNTTS GSESSAQQSN PDGNDHGSSM CALWSNSSIS  300
SRGAWFHDKS IDATPGDIKS FEDVQSRSLD DVSNLNSSPF QVAGMFGRTK KPNLDFTLGR  360
I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369111e-134BT036911.1 Zea mays full-length cDNA clone ZM_BFb0147F05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953561.10.0PREDICTED: probable transcription factor KAN2 isoform X1
TrEMBLB4FIH31e-153B4FIH3_MAIZE; G2-like transcription factor
STRINGSb04g031030.11e-167(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-39G2-like family protein